Lineage for d6cbta1 (6cbt A:445-580)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
    multihelical; segment-swapped dimer
  4. Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) (S)
    automatically mapped to Pfam PF08278
  5. Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (2 proteins)
  6. Protein automated matches [364361] (1 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [364362] (3 PDB entries)
  8. Domain d6cbta1: 6cbt A:445-580 [364371]
    automated match to d1t3wb_
    protein/DNA complex; complexed with acy, zn

Details for d6cbta1

PDB Entry: 6cbt (more details), 2.1 Å

PDB Description: dnag primase c-terminal domain complex with ssb c-terminal peptide
PDB Compounds: (A:) DNA primase, single-stranded DNA-binding protein chimera

SCOPe Domain Sequences for d6cbta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cbta1 a.236.1.1 (A:445-580) automated matches {Escherichia coli [TaxId: 83333]}
qlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqll
ehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthgls
neerlelwtlnqelak

SCOPe Domain Coordinates for d6cbta1 are not available.

Timeline for d6cbta1:

View in 3D
Domains from other chains:
(mouse over for more information)
d6cbtb1