Lineage for d6ca8a_ (6ca8 A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily)
    4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha
  4. Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) (S)
  5. Family e.11.1.0: automated matches [191600] (1 protein)
    not a true family
  6. Protein automated matches [191091] (5 species)
    not a true protein
  7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [364367] (1 PDB entry)
  8. Domain d6ca8a_: 6ca8 A: [364368]
    automated match to d1bjta_

Details for d6ca8a_

PDB Entry: 6ca8 (more details), 2.3299999999999996 Å

PDB Description: crystal structure of plasmodium falciparum topoisomerase ii dna- binding, cleavage and re-ligation domain
PDB Compounds: (A:) DNA topoisomerase 2

SCOPe Domain Sequences for d6ca8a_:

Sequence, based on SEQRES records: (download)

>d6ca8a_ e.11.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
reriigipkledandagskysqectliltegdsaktsclaglsivgrdkygvfplkgkll
nvrdasfkqlmdnkeiqnifrimglditdknkddikglrygslmimtdqdydgshikgll
inmihkfwpsllkhkgflsefvtpivkvqkgsqeysfftiaeyeqwkentnllgwkikyy
kglgtstdrefkqyfsdiknhkimflwtgdrdgdsidmafskkriedrklwlqnfilgsy
vdhkekdlsyydfvnkeliyysrydtersipnimdgwkpgqrkvlygcfkrnlrneckva
qlvgyiaehsayhhgesslqqtiinmaqtfvgsnninflepcgqfgsrkeggkdasaary
iftklasstrsifneyddpilkylneegqkiepqyyipviptilvngcegigtgyssfip
nynykdiidnikryinkeplipmvpwykdfkgriesngktgyetigiinkidndtleite
lpikkwtqdykefleelltdekhqlildyidnsshedicftikmdpaklqkaeeeglekv
fklkstltttnmtlfdpnlklqrysteldilkefcyqrlkayenrksylisklekekrii
snktkfilaivnnelivnkkkkkvlveelyrkgydpykdinkikkeeifeqelldaadnp
edneeiiagitvkdydyllsmpifsltlekvedlltqlkekereleilrnitvetmwlkd
iekveeaiefqrnvelsnree

Sequence, based on observed residues (ATOM records): (download)

>d6ca8a_ e.11.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
reriigipkledandagskysqectliltegdsaktsclaglsivgrdkygvfplkgkll
nvrdasfkqlmdnkeiqnifrimglditdknkddikglrygslmimtdqdydgshikgll
inmihkfwpsllkhkgflsefvtpivkvqkgsqeysfftiaeyeqwkentnllgwkikyy
kglgtstdrefkqyfsdiknhkimflwtgdrdgdsidmafskkriedrklwlqnfilgsy
vdhkekdlsyydfvnkeliyysrydtersipnimdgwkpgqrkvlygcfkrnlrneckva
qlvgyiaehsayhhgesslqqtiinmaqtfvgsnninflepcgqfgsrkeggkdasaary
iftklasstrsifneyddpilkylneegqkiepqyyipviptilvngcegigtgyssfip
nynykdiidnikryinkeplipmvpwykdfkgriesngktgyetigiinkidndtleite
lpikkwtqdykefleelltdekhqlildyidnsshedicftikmdpaklqkaeeeglekv
fklkstltttnmtlfdpnlklqrysteldilkefcyqrlkayenrksylisklekekrii
snktkfilaivnnelivnkkkkkvlveelyrkgydpykdinkeeifeqeledneeiiagi
tvkdydyllsmpifsltlekvedlltqlkekereleilrnitvetmwlkdiekveeaief
qrnvelsnree

SCOPe Domain Coordinates for d6ca8a_ are not available.

Timeline for d6ca8a_: