![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (15 PDB entries) |
![]() | Domain d6bx8e_: 6bx8 E: [364365] Other proteins in same PDB: d6bx8b_, d6bx8d_, d6bx8f_, d6bx8h_ automated match to d3p95a_ complexed with so4 |
PDB Entry: 6bx8 (more details), 1.98 Å
SCOPe Domain Sequences for d6bx8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bx8e_ b.47.1.2 (E:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]} ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
Timeline for d6bx8e_: