Lineage for d6adma_ (6adm A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410774Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2410775Protein automated matches [190988] (16 species)
    not a true protein
  7. 2410849Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries)
  8. 3064296Domain d6adma_: 6adm A: [364358]
    Other proteins in same PDB: d6admr1, d6admr2
    automated match to d3cjia_
    complexed with mg

Details for d6adma_

PDB Entry: 6adm (more details), 2.84 Å

PDB Description: anthrax toxin receptor 1-bound full particles of seneca valley virus in acidic conditions
PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d6adma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6adma_ b.121.4.0 (A:) automated matches {Seneca valley virus [TaxId: 390157]}
stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
tqegaqqddgyfclltprptvasrpatrfglyanpsgsgvlantsldfnfyslacftyfr
sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpfhftgrtprafaskggkvsf
vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafvprpnekkstavkhvavyir
yknarawcpsmlpfrsyk

SCOPe Domain Coordinates for d6adma_:

Click to download the PDB-style file with coordinates for d6adma_.
(The format of our PDB-style files is described here.)

Timeline for d6adma_:

  • d6adma_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-10