Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hwah_: 6hwa H: [364353] Other proteins in same PDB: d6hwaa_, d6hwab_, d6hwac1, d6hwac2, d6hwad_, d6hwae_, d6hwaf_, d6hwag_, d6hwai_, d6hwaj_, d6hwak_, d6hwal_, d6hwan_, d6hwao_, d6hwap_, d6hwaq1, d6hwaq2, d6hwar_, d6hwas_, d6hwat_, d6hwau_, d6hwaw_, d6hwax_, d6hway_, d6hwaz_ automated match to d5fg9h_ complexed with cl, gvw, mes, mg |
PDB Entry: 6hwa (more details), 2.8 Å
SCOPe Domain Sequences for d6hwah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hwah_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hwah_:
View in 3D Domains from other chains: (mouse over for more information) d6hwaa_, d6hwab_, d6hwac1, d6hwac2, d6hwad_, d6hwae_, d6hwaf_, d6hwag_, d6hwai_, d6hwaj_, d6hwak_, d6hwal_, d6hwam_, d6hwan_, d6hwao_, d6hwap_, d6hwaq1, d6hwaq2, d6hwar_, d6hwas_, d6hwat_, d6hwau_, d6hwav_, d6hwaw_, d6hwax_, d6hway_, d6hwaz_ |