Lineage for d6hwah_ (6hwa H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994747Domain d6hwah_: 6hwa H: [364353]
    Other proteins in same PDB: d6hwaa_, d6hwab_, d6hwac1, d6hwac2, d6hwad_, d6hwae_, d6hwaf_, d6hwag_, d6hwai_, d6hwaj_, d6hwak_, d6hwal_, d6hwan_, d6hwao_, d6hwap_, d6hwaq1, d6hwaq2, d6hwar_, d6hwas_, d6hwat_, d6hwau_, d6hwaw_, d6hwax_, d6hway_, d6hwaz_
    automated match to d5fg9h_
    complexed with cl, gvw, mes, mg

Details for d6hwah_

PDB Entry: 6hwa (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with 43
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hwah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwah_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d6hwah_:

Click to download the PDB-style file with coordinates for d6hwah_.
(The format of our PDB-style files is described here.)

Timeline for d6hwah_: