Lineage for d6azba_ (6azb A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. Protein automated matches [190543] (128 species)
    not a true protein
  7. Species Physcomitrella patens [TaxId:3218] [364340] (4 PDB entries)
  8. Domain d6azba_: 6azb A: [364352]
    automated match to d4ih1a_

Details for d6azba_

PDB Entry: 6azb (more details), 2 Å

PDB Description: crystal structure of physcomitrella patens kai2-like e
PDB Compounds: (A:) Pp-KAI2-like E

SCOPe Domain Sequences for d6azba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6azba_ c.69.1.0 (A:) automated matches {Physcomitrella patens [TaxId: 3218]}
lldahnvrvvgmgselvvlghgfgtdqsvwkhviphlvddyrvilfdnmgagttdpeffs
fsrystlhgyaddllsileelevesciyvghsvagmvgclaslerpeiftkiitlsaspr
ylndrdyfggfeqddlnqlfeamqsnfkawvsgfaplavgsdidsmavqefgrtlfnirp
diafsvaktifqsdlrimlpkvtvpchilqsskdlavplvvadylhhalggptivevlpt
eghlpqlsspdiiipvlkrhlag

SCOPe Domain Coordinates for d6azba_ are not available.

Timeline for d6azba_:

Domains from other chains:
(mouse over for more information)
d6azbb_