Lineage for d6admr1 (6adm R:38-220)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892349Protein automated matches [190060] (2 species)
    not a true protein
  7. 2892352Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)
  8. 2892376Domain d6admr1: 6adm R:38-220 [364347]
    Other proteins in same PDB: d6adma_, d6admc_, d6admr2
    automated match to d1shux_
    complexed with mg

Details for d6admr1

PDB Entry: 6adm (more details), 2.84 Å

PDB Description: anthrax toxin receptor 1-bound full particles of seneca valley virus in acidic conditions
PDB Compounds: (R:) Anthrax toxin receptor 1

SCOPe Domain Sequences for d6admr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6admr1 c.62.1.1 (R:38-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmklte
dreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhedl
ffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsilk
ksc

SCOPe Domain Coordinates for d6admr1:

Click to download the PDB-style file with coordinates for d6admr1.
(The format of our PDB-style files is described here.)

Timeline for d6admr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6admr2