SCOPe 2.07: Domain d6adsc_: 6ads C:

Lineage for d6adsc_ (6ads C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (22 species)
   not a true protein

7. Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries)

8. Domain d6adsc_: 6ads C: [364344]
   automated match to d3cjib_

Details for d6adsc_

PDB Entry: 6ads, 2.84 Å

PDB Description: structure of seneca valley virus in acidic conditions

PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d6adsc_:

Sequence, based on SEQRES records:

>d6adsc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]}
piptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrvda
yvpyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmar
gkfllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsvy
sadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

Sequence, based on observed residues (ATOM records):

>d6adsc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]}
piptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrayv
pyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmargk
fllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsvysa
dgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

Timeline for d6adsc_:

• d6adsc_ is new in SCOPe 2.07-stable
  
• d6adsc_ appears in the current release, SCOPe 2.08