SCOP 1.73: Domain d1lhia_: 1lhi A:

Lineage for d1lhia_ (1lhi A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)

8. Domain d1lhia_: 1lhi A: [36434]
   mutant

Details for d1lhia_

PDB Entry: 1lhi, 1.8 Å

PDB Description: role of proline residues in human lysozyme stability: a scanning calorimetric study combined with x-ray structure analysis of proline mutants

PDB Compounds: (A:) human lysozyme

SCOP Domain Sequences for d1lhia_:

Sequence; same for both SEQRES and ATOM records:

>d1lhia_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktggavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1lhia_:

• d1lhia_ first appeared (with stable ids) in SCOP 1.55, called d1lhi__
  
• d1lhia_ was called d1lhi__ in SCOP 1.71
  
• d1lhia_ appears in SCOP 1.75
  
• d1lhia_ appears in the current release, SCOPe 2.08