Lineage for d2meg__ (2meg -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76282Species Human (Homo sapiens) [TaxId:9606] [53969] (174 PDB entries)
  8. 76306Domain d2meg__: 2meg - [36432]

Details for d2meg__

PDB Entry: 2meg (more details), 1.8 Å

PDB Description: changes in conformational stability of a series of mutant human lysozymes at constant positions.

SCOP Domain Sequences for d2meg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2meg__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqsn
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d2meg__:

Click to download the PDB-style file with coordinates for d2meg__.
(The format of our PDB-style files is described here.)

Timeline for d2meg__: