Lineage for d5z22a1 (5z22 A:2-130)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382125Species Cerrena sp. [TaxId:90311] [357121] (2 PDB entries)
  8. 2382132Domain d5z22a1: 5z22 A:2-130 [364309]
    automated match to d1gyca1
    complexed with cu, gol, nag, oxy, so4

Details for d5z22a1

PDB Entry: 5z22 (more details), 1.5 Å

PDB Description: crystal structure of laccase from cerrena sp. rsd1
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d5z22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z22a1 b.6.1.0 (A:2-130) automated matches {Cerrena sp. [TaxId: 90311]}
vgpvtdihivnkdiapdgfsrpsvlaggtfpgplitgqkgdnfklnvvddltdasmlkst
sihwhgffqkgtnwadgpafvnqcpistgnsflynfqvpdqagtywyhshlstqycdglr
gafvvydpt

SCOPe Domain Coordinates for d5z22a1:

Click to download the PDB-style file with coordinates for d5z22a1.
(The format of our PDB-style files is described here.)

Timeline for d5z22a1: