Lineage for d5zs6a_ (5zs6 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383524Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2383525Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2383628Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2383629Protein automated matches [191181] (9 species)
    not a true protein
  7. 2383636Species Mycobacterium marinum [TaxId:216594] [364305] (2 PDB entries)
  8. 2383638Domain d5zs6a_: 5zs6 A: [364306]
    automated match to d5j7na_
    complexed with cl, na, peg, pro

Details for d5zs6a_

PDB Entry: 5zs6 (more details), 2.81 Å

PDB Description: dodecameric structure of a small heat shock protein from mycobacterium marinum m: form-2
PDB Compounds: (A:) Molecular chaperone (Small heat shock protein)

SCOPe Domain Sequences for d5zs6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zs6a_ b.15.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
lgtsarpavmpmdawregdkfvvefdlpgidadsldidiernvvtvraerpavdpnreml
aserprgvfsrqlvlgenldtariaasytegvlklqipvaekakprkisitr

SCOPe Domain Coordinates for d5zs6a_:

Click to download the PDB-style file with coordinates for d5zs6a_.
(The format of our PDB-style files is described here.)

Timeline for d5zs6a_: