Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Unidentified influenza virus [TaxId:11309] [364281] (1 PDB entry) |
Domain d6n4fh_: 6n4f H: [364301] Other proteins in same PDB: d6n4fa_, d6n4fc_, d6n4fe_, d6n4fg_ automated match to d3m5jb_ |
PDB Entry: 6n4f (more details), 3.01 Å
SCOPe Domain Sequences for d6n4fh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n4fh_ h.3.1.1 (H:) automated matches {Unidentified influenza virus [TaxId: 11309]} glfgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdleryvedtkvdlwsynaellvalenqntidltdsemnklfe ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhniyrdeavnnrfq
Timeline for d6n4fh_: