Lineage for d6n4fh_ (6n4f H:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041784Species Unidentified influenza virus [TaxId:11309] [364281] (1 PDB entry)
  8. 3041788Domain d6n4fh_: 6n4f H: [364301]
    Other proteins in same PDB: d6n4fa_, d6n4fc_, d6n4fe_, d6n4fg_
    automated match to d3m5jb_

Details for d6n4fh_

PDB Entry: 6n4f (more details), 3.01 Å

PDB Description: the crystal structure of hemagglutinin from a/canine/il/11613/2015 (h3n2) influenza virus.
PDB Compounds: (H:) hemagglutinin HA2

SCOPe Domain Sequences for d6n4fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n4fh_ h.3.1.1 (H:) automated matches {Unidentified influenza virus [TaxId: 11309]}
glfgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdleryvedtkvdlwsynaellvalenqntidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhniyrdeavnnrfq

SCOPe Domain Coordinates for d6n4fh_:

Click to download the PDB-style file with coordinates for d6n4fh_.
(The format of our PDB-style files is described here.)

Timeline for d6n4fh_: