SCOPe 2.08: Domain d5y2lj2: 5y2l J:130-234

Lineage for d5y2lj2 (5y2l J:130-234)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5y2lj2: 5y2l J:130-234 [364300]
   Other proteins in same PDB: d5y2la_, d5y2lb_
   automated match to d1h3pl2
   complexed with nag

Details for d5y2lj2

PDB Entry: 5y2l, 2.9 Å

PDB Description: crystal structure of a group 2 ha binding antibody af4h1k1 fab in complex with the 1968 h3n2 pandemic (h3-ac/68) hemagglutinin

PDB Compounds: (J:) a group 2 HA binding antibody AF4H1K1 Fab light chain

SCOPe Domain Sequences for d5y2lj2:

Sequence; same for both SEQRES and ATOM records:

>d5y2lj2 b.1.1.0 (J:130-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d5y2lj2:

• d5y2lj2 first appeared in SCOPe 2.07