SCOPe 2.07: Domain d6nnrb_: 6nnr B:

Lineage for d6nnrb_ (6nnr B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)

8. Domain d6nnrb_: 6nnr B: [364279]
   automated match to d1kzia_
   complexed with cb3, epe, na, umc

Details for d6nnrb_

PDB Entry: 6nnr, 1.05 Å

PDB Description: high-resolution structure of wild-type e. coli thymidylate synthase

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d6nnrb_:

Sequence; same for both SEQRES and ATOM records:

>d6nnrb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d6nnrb_:

• d6nnrb_ is new in SCOPe 2.07-stable
  
• d6nnrb_ appears in the current release, SCOPe 2.08