Lineage for d6n4fa_ (6n4f A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385877Species Unidentified influenza virus [TaxId:11309] [364253] (3 PDB entries)
  8. 2385884Domain d6n4fa_: 6n4f A: [364254]
    Other proteins in same PDB: d6n4fb_, d6n4fd_, d6n4ff_, d6n4fh_
    automated match to d2hmga_

Details for d6n4fa_

PDB Entry: 6n4f (more details), 3.01 Å

PDB Description: the crystal structure of hemagglutinin from a/canine/il/11613/2015 (h3n2) influenza virus.
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d6n4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n4fa_ b.19.1.2 (A:) automated matches {Unidentified influenza virus [TaxId: 11309]}
nnaatlclghhavpngtmvktitddqievtnatelvqnsstgkicnnphkildgrdctli
dallgdphcdvfqnetwdlfversnafsncypydvpdyaslrsivassgtlefitegftw
agvtqnggsgackrgpansffsrlnwltksgntypvlnvtmpnnnnfdklyiwgvhhpst
nqeqtslyiqasgrvtvstrrsqqtiipnigsrplvrgqsgrisvywtivkpgdilvins
ngnliaprgyfkmhigkssimrsdapidtcisecitpngsipnekpfqnvnkitygacpk
yvkqntlklatgmrnvp

SCOPe Domain Coordinates for d6n4fa_:

Click to download the PDB-style file with coordinates for d6n4fa_.
(The format of our PDB-style files is described here.)

Timeline for d6n4fa_: