Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (21 species) not a true protein |
Species Unidentified influenza virus [TaxId:11309] [364253] (3 PDB entries) |
Domain d6n4fa_: 6n4f A: [364254] Other proteins in same PDB: d6n4fb_, d6n4fd_, d6n4ff_, d6n4fh_ automated match to d2hmga_ |
PDB Entry: 6n4f (more details), 3.01 Å
SCOPe Domain Sequences for d6n4fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n4fa_ b.19.1.2 (A:) automated matches {Unidentified influenza virus [TaxId: 11309]} nnaatlclghhavpngtmvktitddqievtnatelvqnsstgkicnnphkildgrdctli dallgdphcdvfqnetwdlfversnafsncypydvpdyaslrsivassgtlefitegftw agvtqnggsgackrgpansffsrlnwltksgntypvlnvtmpnnnnfdklyiwgvhhpst nqeqtslyiqasgrvtvstrrsqqtiipnigsrplvrgqsgrisvywtivkpgdilvins ngnliaprgyfkmhigkssimrsdapidtcisecitpngsipnekpfqnvnkitygacpk yvkqntlklatgmrnvp
Timeline for d6n4fa_: