Lineage for d6mrpa_ (6mrp A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338321Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2338322Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2338323Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2338346Protein automated matches [334155] (2 species)
    not a true protein
  7. 2338347Species Bos taurus [TaxId:9913] [352391] (6 PDB entries)
  8. 2338354Domain d6mrpa_: 6mrp A: [364247]
    automated match to d1pbwb_
    mutant

Details for d6mrpa_

PDB Entry: 6mrp (more details), 2.4 Å

PDB Description: structure of the bovine p85a bh domain r228e mutant
PDB Compounds: (A:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d6mrpa_:

Sequence, based on SEQRES records: (download)

>d6mrpa_ a.116.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcdtasl
dlemfdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkkliespsi
phqywltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehlikiiei
listew

Sequence, based on observed residues (ATOM records): (download)

>d6mrpa_ a.116.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcldlem
fdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkkliespsiphqy
wltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehlikiieilist
ew

SCOPe Domain Coordinates for d6mrpa_:

Click to download the PDB-style file with coordinates for d6mrpa_.
(The format of our PDB-style files is described here.)

Timeline for d6mrpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6mrpb_