Lineage for d6mkqa_ (6mkq A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3014002Species Vibrio cholerae [TaxId:666] [364228] (2 PDB entries)
  8. 3014007Domain d6mkqa_: 6mkq A: [364229]
    automated match to d1dy6a_
    complexed with nxl

Details for d6mkqa_

PDB Entry: 6mkq (more details), 1.9 Å

PDB Description: carbapenemase vcc-1 bound to avibactam
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6mkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mkqa_ e.3.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
nknmadieaafegrvgvyaintgsgkaysyranerfplcssfkaflaaavlkmdqdspgv
llekvnyhnrtmephspitekfqsqgmavgelaaatlqysdngaanllmekyikgpegmt
qfmnsigdtkfrldrweldlnsaipgderdtstpkavaeslnklisntvldnyhqeifkk
wmignttgdnriraavpdgwvvgdktgtcgkygtandhafilqgnnaaplilsiyttrkg
ehmkhddeviakaariaienvk

SCOPe Domain Coordinates for d6mkqa_:

Click to download the PDB-style file with coordinates for d6mkqa_.
(The format of our PDB-style files is described here.)

Timeline for d6mkqa_: