SCOP 1.71: Domain d1lmt__: 1lmt -

Lineage for d1lmt__ (1lmt -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)

8. Domain d1lmt__: 1lmt - [36416]
   complexed with cl, nag; mutant

Details for d1lmt__

PDB Entry: 1lmt, 1.6 Å

PDB Description: structure of a conformationally constrained arg-gly-asp sequence inserted into human lysozyme

SCOP Domain Sequences for d1lmt__:

Sequence; same for both SEQRES and ATOM records:

>d1lmt__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavcrgdscnachlscsallqdniadavacakrvvrdpqgirawvawrn
rcqnrdvrqyvqgcgv

Timeline for d1lmt__:

• d1lmt__ first appeared (with stable ids) in SCOP 1.55
  
• d1lmt__ appears in SCOP 1.69
  
• d1lmt__ is called d1lmta_ in SCOP 1.73
  
• d1lmt__ appears in the current release, SCOPe 2.08, called d1lmta_