Lineage for d1lmt__ (1lmt -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (14 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (174 PDB entries) 
Domain d1lmt__: 1lmt - [36416]
Details for d1lmt__
PDB Entry: 1lmt (more details), 1.6 Å
PDB Description: structure of a conformationally constrained arg-gly-asp sequence inserted into human lysozyme
SCOP Domain Sequences for d1lmt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmt__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavcrgdscnachlscsallqdniadavacakrvvrdpqgirawvawrn
rcqnrdvrqyvqgcgv
SCOP Domain Coordinates for d1lmt__:
Click to download the PDB-style file with coordinates for d1lmt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lmt__:
- d1lmt__ first appeared (with stable ids) in SCOP 1.55
- d1lmt__ appears in SCOP 1.59
- d1lmt__ appears in the current release, SCOPe 2.08, called d1lmta_
View in 3D