Lineage for d2ihl__ (2ihl -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252446Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [53967] (1 PDB entry)
  8. 252447Domain d2ihl__: 2ihl - [36408]
    complexed with na

Details for d2ihl__

PDB Entry: 2ihl (more details), 1.4 Å

PDB Description: lysozyme (e.c.3.2.1.17) (japanese quail)
PDB Compounds: ( :)

SCOP Domain Sequences for d2ihl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihl__ d.2.1.2 (-) Lysozyme {Japanese quail (Coturnix coturnix japonica)}
kvygrcelaaamkrhgldkyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdvhgmnawvawrnrckgtdv
nawirgcrl

SCOP Domain Coordinates for d2ihl__:

Click to download the PDB-style file with coordinates for d2ihl__.
(The format of our PDB-style files is described here.)

Timeline for d2ihl__: