Lineage for d1dkkb_ (1dkk B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28805Species Bobwhite quail (Colinus virginianus) [TaxId:9014] [53966] (3 PDB entries)
  8. 28807Domain d1dkkb_: 1dkk B: [36405]

Details for d1dkkb_

PDB Entry: 1dkk (more details), 1.9 Å

PDB Description: bobwhite quail lysozyme with nitrate
PDB Compounds: (B:)

SCOP Domain Sequences for d1dkkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkkb_ d.2.1.2 (B:) Lysozyme {Bobwhite quail (Colinus virginianus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1dkkb_:

Click to download the PDB-style file with coordinates for d1dkkb_.
(The format of our PDB-style files is described here.)

Timeline for d1dkkb_: