Lineage for d1jhla_ (1jhl A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1397278Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1397338Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1398106Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries)
  8. 1398109Domain d1jhla_: 1jhl A: [36403]
    Other proteins in same PDB: d1jhlh_, d1jhll_

Details for d1jhla_

PDB Entry: 1jhl (more details), 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex
PDB Compounds: (A:) pheasant egg white lysozyme

SCOPe Domain Sequences for d1jhla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhla_ d.2.1.2 (A:) Lysozyme {Pheasant (Phasianus colchicus) [TaxId: 9054]}
kvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqins
rwwcndgrtpgsknlchipcsallssditasvncakkivsdgdgmnawvawrkhckgtdv
nvwirgcrl

SCOPe Domain Coordinates for d1jhla_:

Click to download the PDB-style file with coordinates for d1jhla_.
(The format of our PDB-style files is described here.)

Timeline for d1jhla_: