![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries) |
![]() | Domain d1jhla_: 1jhl A: [36403] Other proteins in same PDB: d1jhlh_, d1jhll_ |
PDB Entry: 1jhl (more details), 2.4 Å
SCOP Domain Sequences for d1jhla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhla_ d.2.1.2 (A:) Lysozyme {Pheasant (Phasianus colchicus)} kvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqins rwwcndgrtpgsknlchipcsallssditasvncakkivsdgdgmnawvawrkhckgtdv nvwirgcrl
Timeline for d1jhla_: