Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hwcm_: 6hwc M: [364024] Other proteins in same PDB: d6hwcb_, d6hwcc1, d6hwcc2, d6hwcd_, d6hwce_, d6hwcf_, d6hwcg_, d6hwci_, d6hwcj_, d6hwck_, d6hwcl_, d6hwcn_, d6hwco_, d6hwcp_, d6hwcq1, d6hwcq2, d6hwcr_, d6hwcs_, d6hwct_, d6hwcu_, d6hwcw_, d6hwcx_, d6hwcy_, d6hwcz_ automated match to d4j70m_ complexed with cl, mes, mg, so4; mutant |
PDB Entry: 6hwc (more details), 2.8 Å
SCOPe Domain Sequences for d6hwcm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hwcm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d6hwcm_:
View in 3D Domains from other chains: (mouse over for more information) d6hwca_, d6hwcb_, d6hwcc1, d6hwcc2, d6hwcd_, d6hwce_, d6hwcf_, d6hwcg_, d6hwch_, d6hwci_, d6hwcj_, d6hwck_, d6hwcl_, d6hwcn_, d6hwco_, d6hwcp_, d6hwcq1, d6hwcq2, d6hwcr_, d6hwcs_, d6hwct_, d6hwcu_, d6hwcv_, d6hwcw_, d6hwcx_, d6hwcy_, d6hwcz_ |