SCOP 1.63: Domain d1ghlb_: 1ghl B:

Lineage for d1ghlb_ (1ghl B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (16 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Pheasant (Phasianus colchicus) [TaxId:9054] [53965] (2 PDB entries)

8. Domain d1ghlb_: 1ghl B: [36402]

Details for d1ghlb_

PDB Entry: 1ghl, 2.1 Å

PDB Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes

SCOP Domain Sequences for d1ghlb_:

Sequence; same for both SEQRES and ATOM records:

>d1ghlb_ d.2.1.2 (B:) Lysozyme {Pheasant (Phasianus colchicus)}
gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
vnvwirgcrl

Timeline for d1ghlb_:

• d1ghlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ghlb_ appears in SCOP 1.61
  
• d1ghlb_ appears in SCOP 1.65
  
• d1ghlb_ appears in the current release, SCOPe 2.08