Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hw9v_: 6hw9 V: [364005] Other proteins in same PDB: d6hw9a_, d6hw9c2, d6hw9e_, d6hw9g_, d6hw9i_, d6hw9j_, d6hw9k_, d6hw9l_, d6hw9n_, d6hw9o_, d6hw9q2, d6hw9s_, d6hw9u_, d6hw9w_, d6hw9x_, d6hw9y_, d6hw9z_ automated match to d5fg9h_ complexed with cl, gwk, mes, mg |
PDB Entry: 6hw9 (more details), 2.8 Å
SCOPe Domain Sequences for d6hw9v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hw9v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hw9v_:
View in 3D Domains from other chains: (mouse over for more information) d6hw9a_, d6hw9b_, d6hw9c1, d6hw9c2, d6hw9d_, d6hw9e_, d6hw9f_, d6hw9g_, d6hw9h_, d6hw9i_, d6hw9j_, d6hw9k_, d6hw9l_, d6hw9m_, d6hw9n_, d6hw9o_, d6hw9p_, d6hw9q1, d6hw9q2, d6hw9r_, d6hw9s_, d6hw9t_, d6hw9u_, d6hw9w_, d6hw9x_, d6hw9y_, d6hw9z_ |