Lineage for d1lz2a_ (1lz2 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1397278Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1397338Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1398122Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 1398136Domain d1lz2a_: 1lz2 A: [36397]
    CA-atoms only

Details for d1lz2a_

PDB Entry: 1lz2 (more details), 2.8 Å

PDB Description: crystallographic study of turkey egg-white lysozyme and its complex with a disaccharide
PDB Compounds: (A:) turkey egg white lysozyme

SCOPe Domain Sequences for d1lz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lz2a_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntngstdygilqins
rwwcdngrtpgsrnlcnipcsallssditasvncakkiasggdgmnawvawrnrckgtdv
hawirgcrl

SCOPe Domain Coordinates for d1lz2a_:

Click to download the PDB-style file with coordinates for d1lz2a_.
(The format of our PDB-style files is described here.)

Timeline for d1lz2a_: