Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries) |
Domain d3lz2a_: 3lz2 A: [36396] |
PDB Entry: 3lz2 (more details), 2.5 Å
SCOP Domain Sequences for d3lz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lz2a_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]} kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv hawirgcrl
Timeline for d3lz2a_: