Lineage for d3lz2__ (3lz2 -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252470Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (12 PDB entries)
  8. 252483Domain d3lz2__: 3lz2 - [36396]

Details for d3lz2__

PDB Entry: 3lz2 (more details), 2.5 Å

PDB Description: structure determination of turkey egg white lysozyme using laue diffraction
PDB Compounds: ( :)

SCOP Domain Sequences for d3lz2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lz2__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOP Domain Coordinates for d3lz2__:

Click to download the PDB-style file with coordinates for d3lz2__.
(The format of our PDB-style files is described here.)

Timeline for d3lz2__: