SCOP 1.69: Domain d2lz2__: 2lz2 -

Lineage for d2lz2__ (2lz2 -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d2lz2__: 2lz2 - [36395]

Details for d2lz2__

PDB Entry: 2lz2, 2.2 Å

PDB Description: the three dimensional structure of turkey egg white lysozyme at 2.2 angstroms resolution

SCOP Domain Sequences for d2lz2__:

Sequence; same for both SEQRES and ATOM records:

>d2lz2__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

Timeline for d2lz2__:

• d2lz2__ first appeared (with stable ids) in SCOP 1.55
  
• d2lz2__ appears in SCOP 1.67
  
• d2lz2__ appears in SCOP 1.71
  
• d2lz2__ appears in the current release, SCOPe 2.08, called d2lz2a_