Lineage for d1dzby_ (1dzb Y:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632263Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1632323Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1633195Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 1633206Domain d1dzby_: 1dzb Y: [36394]
    Other proteins in same PDB: d1dzba1, d1dzba2, d1dzbb1, d1dzbb2

Details for d1dzby_

PDB Entry: 1dzb (more details), 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme
PDB Compounds: (Y:) turkey egg-white lysozyme c

SCOPe Domain Sequences for d1dzby_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzby_ d.2.1.2 (Y:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOPe Domain Coordinates for d1dzby_:

Click to download the PDB-style file with coordinates for d1dzby_.
(The format of our PDB-style files is described here.)

Timeline for d1dzby_: