Lineage for d6hw4v_ (6hw4 V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994898Domain d6hw4v_: 6hw4 V: [363927]
    Other proteins in same PDB: d6hw4a_, d6hw4b_, d6hw4c1, d6hw4c2, d6hw4d_, d6hw4e_, d6hw4f_, d6hw4g_, d6hw4i_, d6hw4j_, d6hw4k_, d6hw4l_, d6hw4n_, d6hw4o_, d6hw4p_, d6hw4q1, d6hw4q2, d6hw4r_, d6hw4s_, d6hw4t_, d6hw4u_, d6hw4w_, d6hw4x_, d6hw4y_, d6hw4z_
    automated match to d5fg9h_
    complexed with cl, grw, mg

Details for d6hw4v_

PDB Entry: 6hw4 (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with 16
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hw4v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw4v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d6hw4v_:

Click to download the PDB-style file with coordinates for d6hw4v_.
(The format of our PDB-style files is described here.)

Timeline for d6hw4v_: