Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hw4v_: 6hw4 V: [363927] Other proteins in same PDB: d6hw4a_, d6hw4b_, d6hw4c1, d6hw4c2, d6hw4d_, d6hw4e_, d6hw4f_, d6hw4g_, d6hw4i_, d6hw4j_, d6hw4k_, d6hw4l_, d6hw4n_, d6hw4o_, d6hw4p_, d6hw4q1, d6hw4q2, d6hw4r_, d6hw4s_, d6hw4t_, d6hw4u_, d6hw4w_, d6hw4x_, d6hw4y_, d6hw4z_ automated match to d5fg9h_ complexed with cl, grw, mg |
PDB Entry: 6hw4 (more details), 2.9 Å
SCOPe Domain Sequences for d6hw4v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hw4v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hw4v_:
View in 3D Domains from other chains: (mouse over for more information) d6hw4a_, d6hw4b_, d6hw4c1, d6hw4c2, d6hw4d_, d6hw4e_, d6hw4f_, d6hw4g_, d6hw4h_, d6hw4i_, d6hw4j_, d6hw4k_, d6hw4l_, d6hw4m_, d6hw4n_, d6hw4o_, d6hw4p_, d6hw4q1, d6hw4q2, d6hw4r_, d6hw4s_, d6hw4t_, d6hw4u_, d6hw4w_, d6hw4x_, d6hw4y_, d6hw4z_ |