Lineage for d1jefa_ (1jef A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190374Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1190375Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1190400Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1190460Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1191044Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 1191051Domain d1jefa_: 1jef A: [36392]
    complexed with so4

Details for d1jefa_

PDB Entry: 1jef (more details), 1.77 Å

PDB Description: turkey lysozyme complex with (glcnac)3
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1jefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jefa_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOPe Domain Coordinates for d1jefa_:

Click to download the PDB-style file with coordinates for d1jefa_.
(The format of our PDB-style files is described here.)

Timeline for d1jefa_: