SCOP 1.71: Domain d1jef__: 1jef -

Lineage for d1jef__ (1jef -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d1jef__: 1jef - [36392]
   complexed with nag, so4

Details for d1jef__

PDB Entry: 1jef, 1.77 Å

PDB Description: turkey lysozyme complex with (glcnac)3

SCOP Domain Sequences for d1jef__:

Sequence; same for both SEQRES and ATOM records:

>d1jef__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

Timeline for d1jef__:

• d1jef__ first appeared (with stable ids) in SCOP 1.55
  
• d1jef__ appears in SCOP 1.69
  
• d1jef__ is called d1jefa_ in SCOP 1.73
  
• d1jef__ appears in the current release, SCOPe 2.08, called d1jefa_