Lineage for d1jef__ (1jef -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252470Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (12 PDB entries)
  8. 252477Domain d1jef__: 1jef - [36392]
    complexed with nag, so4

Details for d1jef__

PDB Entry: 1jef (more details), 1.77 Å

PDB Description: turkey lysozyme complex with (glcnac)3
PDB Compounds: ( :)

SCOP Domain Sequences for d1jef__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jef__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOP Domain Coordinates for d1jef__:

Click to download the PDB-style file with coordinates for d1jef__.
(The format of our PDB-style files is described here.)

Timeline for d1jef__: