Lineage for d1tewa_ (1tew A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2531455Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2532707Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 2532712Domain d1tewa_: 1tew A: [36391]
    complexed with scn

Details for d1tewa_

PDB Entry: 1tew (more details), 1.65 Å

PDB Description: structure of hexagonal turkey egg white lysozyme at 1.65 angstroms resolution
PDB Compounds: (A:) turkey egg white lysozyme

SCOPe Domain Sequences for d1tewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tewa_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcr

SCOPe Domain Coordinates for d1tewa_:

Click to download the PDB-style file with coordinates for d1tewa_.
(The format of our PDB-style files is described here.)

Timeline for d1tewa_: