Lineage for d1tew__ (1tew -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187287Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 187288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 187297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 187345Protein Lysozyme [53961] (16 species)
  7. 187760Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (12 PDB entries)
  8. 187766Domain d1tew__: 1tew - [36391]

Details for d1tew__

PDB Entry: 1tew (more details), 1.65 Å

PDB Description: structure of hexagonal turkey egg white lysozyme at 1.65 angstroms resolution
PDB Compounds: ( :)

SCOP Domain Sequences for d1tew__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tew__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcr

SCOP Domain Coordinates for d1tew__:

Click to download the PDB-style file with coordinates for d1tew__.
(The format of our PDB-style files is described here.)

Timeline for d1tew__: