Lineage for d1lz3__ (1lz3 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (13 species) 
Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (10 PDB entries) 
Domain d1lz3__: 1lz3 - [36390]
Details for d1lz3__
PDB Entry: 1lz3 (more details), 1.5 Å
PDB Description: x-ray structure of monoclinic turkey egg lysozyme at 1.3 a resolution
SCOP Domain Sequences for d1lz3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lz3__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfdthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggdgmnawvawrnrckgtdv
hawirgcrl
SCOP Domain Coordinates for d1lz3__:
Click to download the PDB-style file with coordinates for d1lz3__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lz3__:
- d1lz3__ appears in SCOP 1.57
- d1lz3__ last appears in SCOP 1.71
View in 3D