![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries) |
![]() | Domain d1lzya_: 1lzy A: [36389] |
PDB Entry: 1lzy (more details), 1.55 Å
SCOPe Domain Sequences for d1lzya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lzya_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]} kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv hawirgcrl
Timeline for d1lzya_: