Lineage for d135l__ (135l -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 595969Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 596021Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 596503Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 596506Domain d135l__: 135l - [36388]

Details for d135l__

PDB Entry: 135l (more details), 1.3 Å

PDB Description: x-ray structure of monoclinic turkey egg lysozyme at 1.3 angstroms resolution

SCOP Domain Sequences for d135l__:

Sequence; same for both SEQRES and ATOM records: (download)

>d135l__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOP Domain Coordinates for d135l__:

Click to download the PDB-style file with coordinates for d135l__.
(The format of our PDB-style files is described here.)

Timeline for d135l__: