Lineage for d1jse__ (1jse -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252470Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (12 PDB entries)
  8. 252471Domain d1jse__: 1jse - [36387]
    complexed with pol

Details for d1jse__

PDB Entry: 1jse (more details), 1.12 Å

PDB Description: full-matrix least-squares refinement of turkey lysozyme
PDB Compounds: ( :)

SCOP Domain Sequences for d1jse__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jse__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOP Domain Coordinates for d1jse__:

Click to download the PDB-style file with coordinates for d1jse__.
(The format of our PDB-style files is described here.)

Timeline for d1jse__: