![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [53962] (187 PDB entries) |
![]() | Domain d1bvkc_: 1bvk C: [36381] Other proteins in same PDB: d1bvka_, d1bvkb_, d1bvkd_, d1bvke_ |
PDB Entry: 1bvk (more details), 2.7 Å
SCOP Domain Sequences for d1bvkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvkc_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1bvkc_: