Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hvsm_: 6hvs M: [363809] Other proteins in same PDB: d6hvsa_, d6hvsc2, d6hvse_, d6hvsg_, d6hvsi_, d6hvsj_, d6hvsk_, d6hvsl_, d6hvsn_, d6hvso_, d6hvsq2, d6hvss_, d6hvsu_, d6hvsw_, d6hvsx_, d6hvsy_, d6hvsz_ automated match to d4j70m_ complexed with cl, grt, mg |
PDB Entry: 6hvs (more details), 3.1 Å
SCOPe Domain Sequences for d6hvsm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvsm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d6hvsm_:
View in 3D Domains from other chains: (mouse over for more information) d6hvsa_, d6hvsb_, d6hvsc1, d6hvsc2, d6hvsd_, d6hvse_, d6hvsf_, d6hvsg_, d6hvsh_, d6hvsi_, d6hvsj_, d6hvsk_, d6hvsl_, d6hvsn_, d6hvso_, d6hvsp_, d6hvsq1, d6hvsq2, d6hvsr_, d6hvss_, d6hvst_, d6hvsu_, d6hvsv_, d6hvsw_, d6hvsx_, d6hvsy_, d6hvsz_ |