SCOPe 2.08: Domain d6hv5d_: 6hv5 D:

Lineage for d6hv5d_ (6hv5 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d6hv5d_: 6hv5 D: [363785]
   Other proteins in same PDB: d6hv5c2, d6hv5e_, d6hv5g_, d6hv5i_, d6hv5j_, d6hv5k_, d6hv5l_, d6hv5n_, d6hv5o_, d6hv5q2, d6hv5s_, d6hv5u_, d6hv5w_, d6hv5x_, d6hv5y_, d6hv5z_
   automated match to d1rype_
   complexed with cl, gqh, mg

Details for d6hv5d_

PDB Entry: 6hv5, 3 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 4

PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6hv5d_:

Sequence, based on SEQRES records:

>d6hv5d_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records):

>d6hv5d_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

Timeline for d6hv5d_:

• d6hv5d_ first appeared in SCOPe 2.07