Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hvth_: 6hvt H: [363693] Other proteins in same PDB: d6hvta_, d6hvtb_, d6hvtc1, d6hvtc2, d6hvtd_, d6hvte_, d6hvtf_, d6hvtg_, d6hvti_, d6hvtj_, d6hvtk_, d6hvtl_, d6hvtn_, d6hvto_, d6hvtp_, d6hvtq1, d6hvtq2, d6hvtr_, d6hvts_, d6hvtt_, d6hvtu_, d6hvtw_, d6hvtx_, d6hvty_, d6hvtz_ automated match to d5fg9h_ complexed with cl, gt5, mg |
PDB Entry: 6hvt (more details), 2.9 Å
SCOPe Domain Sequences for d6hvth_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvth_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttiaglvfqdgvilgadtratndsvvadkscekihfiapkiyccgagvaadaeavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d6hvth_:
View in 3D Domains from other chains: (mouse over for more information) d6hvta_, d6hvtb_, d6hvtc1, d6hvtc2, d6hvtd_, d6hvte_, d6hvtf_, d6hvtg_, d6hvti_, d6hvtj_, d6hvtk_, d6hvtl_, d6hvtm_, d6hvtn_, d6hvto_, d6hvtp_, d6hvtq1, d6hvtq2, d6hvtr_, d6hvts_, d6hvtt_, d6hvtu_, d6hvtv_, d6hvtw_, d6hvtx_, d6hvty_, d6hvtz_ |