SCOPe 2.08: Domain d6hvyc1: 6hvy C:1-234

Lineage for d6hvyc1 (6hvy C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d6hvyc1: 6hvy C:1-234 [363568]
   Other proteins in same PDB: d6hvya_, d6hvyc2, d6hvyh_, d6hvyi_, d6hvyj_, d6hvyk_, d6hvyl_, d6hvym_, d6hvyn_, d6hvyq2, d6hvyv_, d6hvyw_, d6hvyx_, d6hvyy_, d6hvyz_
   automated match to d4cr2d_
   complexed with cl, gvz, gw2, mes, mg

Details for d6hvyc1

PDB Entry: 6hvy, 2.7 Å

PDB Description: yeast 20s proteasome in complex with 5 (7- and 6-membered ring)

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hvyc1:

Sequence; same for both SEQRES and ATOM records:

>d6hvyc1 d.153.1.4 (C:1-234) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d6hvyc1:

• d6hvyc1 first appeared in SCOPe 2.07, called d6hvyc_