Lineage for d6hubv_ (6hub V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995063Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)
  8. 2995158Domain d6hubv_: 6hub V: [363543]
    Other proteins in same PDB: d6huba_, d6hubb_, d6hubc1, d6hubc2, d6hubd_, d6hube_, d6hubf_, d6hubg_, d6hubi_, d6hubj_, d6hubk_, d6hubl_, d6hubn_, d6hubo_, d6hubp_, d6hubq1, d6hubq2, d6hubr_, d6hubs_, d6hubt_, d6hubu_, d6hubw_, d6hubx_, d6huby_, d6hubz_
    automated match to d5le5h_
    complexed with cl, grw, mg, so4

Details for d6hubv_

PDB Entry: 6hub (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 16
PDB Compounds: (V:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6hubv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hubv_ d.153.1.4 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsggnidlcvisk
nkldflrpytvpnkkgtrlgryrcekgttavltekitpl

SCOPe Domain Coordinates for d6hubv_:

Click to download the PDB-style file with coordinates for d6hubv_.
(The format of our PDB-style files is described here.)

Timeline for d6hubv_: