Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (457 PDB entries) Uniprot P00698 |
Domain d1g7ic_: 1g7i C: [36353] Other proteins in same PDB: d1g7ia_, d1g7ib_ complexed with po4; mutant |
PDB Entry: 1g7i (more details), 1.8 Å
SCOPe Domain Sequences for d1g7ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7ic_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1g7ic_: