SCOP 1.65: Domain d1lsz__: 1lsz -

Lineage for d1lsz__ (1lsz -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Chicken (Gallus gallus) [TaxId:9031] [53962] (169 PDB entries)

8. Domain d1lsz__: 1lsz - [36352]
   complexed with nag; mutant

Details for d1lsz__

PDB Entry: 1lsz, 2 Å

PDB Description: crystal structure of the mutant d52s hen egg white lysozyme with an oligosaccharide product

SCOP Domain Sequences for d1lsz__:

Sequence; same for both SEQRES and ATOM records:

>d1lsz__ d.2.1.2 (-) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstsygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

Timeline for d1lsz__:

• d1lsz__ first appeared (with stable ids) in SCOP 1.55
  
• d1lsz__ appears in SCOP 1.63
  
• d1lsz__ appears in SCOP 1.67
  
• d1lsz__ appears in the current release, SCOPe 2.08, called d1lsza_